SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037858 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037858
Domain Number 1 Region: 360-453
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-20
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 2 Region: 552-640
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 250-301
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000249
Family Second domain of FERM 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000037858
Domain Number - Region: 465-551
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000196
Family Second domain of FERM 0.0059
Further Details:      
 
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0108
Family Ras-binding domain, RBD 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037858   Gene: ENSMUSG00000024965   Transcript: ENSMUST00000040772
Sequence length 665
Comment pep:known chromosome:NCBIM37:19:7073448:7093959:-1 gene:ENSMUSG00000024965 transcript:ENSMUST00000040772
Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPL
FQTVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEEVHDLTKVVLAGGVAPTLFRG
MPAHFSDSAQTEACYHMLSRPQPAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQG
IKAGDVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYH
INKLTLSGDVGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFR
PRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKL
LVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQRAGG
SNGGSGNKPQGPEAPAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLTEAQLR
FIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNV
NWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTG
GHEAF
Download sequence
Identical sequences Q3TEE6 Q8K1B8
ENSMUSP00000037858 ENSMUSP00000037858 NP_722490.1.92730 XP_006526656.1.92730 10090.ENSMUSP00000037858 ENSMUSP00000037858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]