SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000037978 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000037978
Domain Number 1 Region: 510-710
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-22
Family SPRY domain 0.0065
Further Details:      
 
Domain Number 2 Region: 204-266
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.75e-16
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 432-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000054
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 4 Region: 25-64,112-147
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000381
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000037978
Domain Number - Region: 251-326
Classification Level Classification E-value
Superfamily Prefoldin 0.0288
Family Prefoldin 0.017
Further Details:      
 
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0459
Family ZZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000037978   Gene: ENSMUSG00000033949   Transcript: ENSMUST00000037011
Sequence length 729
Comment pep:known chromosome:NCBIM37:18:46324956:46372261:-1 gene:ENSMUSG00000033949 transcript:ENSMUST00000037011
Sequence
MSESEEISEFGYIMELLAKGKVTIKNIEKELICPACKELFTHPLILPCQHSVCHKCVKEL
LLSLDDSFNDVASDSSNQSSPRLRLTSPSMDKIDKINRPGWKRNSLTPRPTTFPCPGCEH
DVDLGERGVSGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIYHPWGTVKAQHEYVGPTTNFRPKVLMCPEHETERINMYCELCRRPVCHLCKLGGN
HSNHRVTTMSSAYKTLKEKLSKDIDFLIGKESQVKSQISELNLLMKETECNGERAKEEAL
AHFEKLFEILEDRKSSVLKAIDASKKLRLDKFHTQMEEYQGLLENNGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQASFEDYVVNISKQTEVLGELSFFSSGIDIP
EINEEQSKVYNNALIDWHHPEKDKADSYVLEYRKINRDEEMISWNEIEVHGTSKVVSNLE
SNSPYAFRVRAYRGSICSPCSRELILHTPPAPVFSFLFDEKCGYNTEHLLLNLKRDRVES
RAGFNVLLAAERIQVGHYTSLDYIIGDVGVTKGKHFWACRVEPYSYLVKVGVASSDKLQE
WLRSPRDAASPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRV
LPMPTSIGIFLDCDKGKVSFYDMDHMKCLYERQVDCSHTMYPAFALMGSGGIQLEEAITA
KYLEYEEDV
Download sequence
Identical sequences Q80WG7
ENSMUSP00000037978 ENSMUSP00000037978 10090.ENSMUSP00000037978 NP_849203.2.92730 ENSMUSP00000037978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]