SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038130 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038130
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 9.06e-23
Family Pleckstrin-homology domain (PH domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000235
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038130   Gene: ENSMUSG00000038781   Transcript: ENSMUST00000043785
Sequence length 411
Comment pep:known chromosome:NCBIM37:17:56136504:56144993:-1 gene:ENSMUSG00000038781 transcript:ENSMUST00000043785
Sequence
MATALSPPRGPKLKGAPPSHYYESFLEKKGPCDQDYRKFWAGLQGLAICFYNSNRDLQPL
EKLDLRLFSKLRDEALLGSSRDTAYHFSLVLRDQEVKFKVESLESCEMWKGFILTVVELR
VPSNLTLLPGHLYMMAEVLTKEEVRRAAEVPWCFLQVSRLEAQLLLERYPECGNLLLRPG
GDGKDSVSVTTRQILNGSPVVKHYKVKRAGSKYVIDVEDPFSCPSLEAVVNYFVTHTKRA
LVPFLLDEDYEKVLGFVDSDRENGESAWAVPSFRASGPALPANVLKPLPPVPVSVSSQED
KLPQLPPLPQLPDTDENYVTPIEDSPAAEYMNQDVSLSSQAVPLKPKKPARLPAKPPKPS
VVPKPDLKAITSVWTRKLGGSSSQASSLVTRLGDITAELEEKLQKRRALEH
Download sequence
Identical sequences Q8R0L1
NP_666046.1.92730 XP_017172690.1.92730 ENSMUSP00000038130 ENSMUSP00000038130 ENSMUSP00000038130 GO.34616 10090.ENSMUSP00000038130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]