SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038373 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038373
Domain Number 1 Region: 388-680,783-825
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.26e-72
Family FAD-linked reductases, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 661-773
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.35e-23
Family L-aminoacid/polyamine oxidase 0.00034
Further Details:      
 
Domain Number 3 Region: 278-383
Classification Level Classification E-value
Superfamily Homeodomain-like 8.6e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038373   Gene: ENSMUSG00000038080   Transcript: ENSMUST00000037025
Sequence length 826
Comment pep:known chromosome:NCBIM37:13:47138868:47179969:1 gene:ENSMUSG00000038080 transcript:ENSMUST00000037025
Sequence
MAASRGRSKKRSNLELSPDNLPLRSSGRQAKKKAVEIPDEDEDGSSEKKYRKCEKAGCTA
AYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYSAWKRVWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECGKWRQLTKEIQLTPHMARTYRCGMKPNTITKPD
TPDHCSFPEDLRVLEVSNHWWYPMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRA
TVTAATTTTGSASPGEMEPSKAAPSSLVLGMNRYFQPFYQPNECGKALCVRPDVMELDEL
YEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILY
FMTRKGLINTGVLTVAAGQHLLPKHYHNKSVLVVGAGPAGLAAARQLHNFGMKVTVLEAK
DRIGGRVWDDKSFKGVVVGRGPQIVNGCINNPVALMCEQLGISMRKLGERCDLIQEGGRI
TDPTVDKRMDFHFNALLDVVSEWRKDKTLLQDVPLGEKIEEIYRAFVKESGIQFSELEGQ
VLQFHLSNLEYACGSSLHQVSARSWDHNEFFAQFAGDHTLLTPGYSTIIEKLAEGLDIRL
KSPVQSIDYTGDEVQVTTTDGMGHSAQKVLVTVPLAILQRGAIQFNPPLSEKKMKAINSL
GAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASQRGLFAVFYDMDSQQSVLMSVITGE
AVASLRTMDDKQVLQQCMGILRELFKEQEIPEPTKYFVTRWSTEPWIQMAYSFVKTFGSG
EAYDIIAEEIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences Q8CIG3
10090.ENSMUSP00000038373 NP_758466.1.92730 ENSMUSP00000038373 ENSMUSP00000038373 ENSMUSP00000038373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]