SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038430 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038430
Domain Number 1 Region: 291-437
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 493-607
Classification Level Classification E-value
Superfamily PX domain 3.01e-23
Family PX domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000038430
Domain Number - Region: 36-129
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0314
Family Cytochrome c oxidase subunit E 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038430   Gene: ENSMUSG00000020590   Transcript: ENSMUST00000048519
Sequence length 888
Comment pep:known chromosome:NCBIM37:12:35731861:35832141:1 gene:ENSMUSG00000020590 transcript:ENSMUST00000048519
Sequence
MKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNA
LIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQRVTEKDDQVKGTAEDLVETFFEV
EVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQSKIMRYFVREILARGILL
PLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSL
DTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTVKLAANFGKLCTVPLDSILVD
NVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVLSGRQRDGKQQTNQTKGLLRA
AAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVYELMLRDERFY
PSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSSVTSDDSVQ
LHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRNLNTEEMWKTYRRYSDFHDFH
MRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCV
YDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGVTKMSDNVGRMS
ERLGQDIKQSFFKVPPLITKTDSDPEHCRVSAQLDDNVDDNIPLRVMLLLMDEVFDLKER
NQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDAFWPNGILAE
TVPCRDKAIRMRTRIAGKTKLFAIMPDELKHIIGAETTRKGILRVFEMFQHNQLNRRMVY
VFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQSTQAPSLQKR
Download sequence
Identical sequences ENSMUSP00000038430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]