SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039519 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039519
Domain Number 1 Region: 91-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-55
Family SPRY domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 5-76
Classification Level Classification E-value
Superfamily RING/U-box 0.000000048
Family RING finger domain, C3HC4 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039519   Gene: ENSMUSG00000035191   Transcript: ENSMUST00000045215
Sequence length 287
Comment pep:known chromosome:NCBIM37:7:5061389:5068513:-1 gene:ENSMUSG00000035191 transcript:ENSMUST00000045215
Sequence
MAHLFKEKSNCYFCFRCLESPVYLNCGYICCLKCLDSLEKSPEGDGVLCPTCSVVSLKED
IIHAKQLGALVTKIKNLEPQLNFILTMDQGMKIFQVTMTLDVDTAQNHLIISDDLLSVYY
TPQKQARKKCAERFHPSPCVLGSSRFTSGRHYWEVVVGTSKEWDIGICKESINRKKAIHL
SEKNGFWTVGVRAKKVYSASTDPLTVLRVNPRLRRVGIFLDMLEKSVSFWDLSDGSHIYT
FLEIPDTDPFRPFFSPASSYPDGDQEQVLSICPVTNPGIFGIPVNPQ
Download sequence
Identical sequences Q8VH31
ENSMUSP00000039519 ENSMUSP00000136497 10090.ENSMUSP00000039519 NP_001138485.1.92730 NP_620404.1.92730 ENSMUSP00000039519 ENSMUSP00000039519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]