SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039580 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039580
Domain Number 1 Region: 1224-1514
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.3e-75
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000233
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000039580
Domain Number - Region: 523-713
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00178
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039580   Gene: ENSMUSG00000036057   Transcript: ENSMUST00000040021
Sequence length 1692
Comment pep:known chromosome:NCBIM37:9:110287593:110310714:-1 gene:ENSMUSG00000036057 transcript:ENSMUST00000040021
Sequence
MEAVPRMPMIWLDLKEAGDFHFQSAVKKFVLKNYGENPEAYNEELKKLELLRQNAIRVAR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVAVTWTEIFSGKSVSHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAFSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
AMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMLAKIEDKNEVLDQFMDSMQLDPETVDNLDAYNHIPPQ
LMEKCAALSVRPDTVKNLVQSMQVLSGVFTDVEASLKDIRDLLEEDELQEQKLQETLGQA
GAGPGPSVAKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRA
ALPTPALTPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEM
KKLFEEQLKKYDQLKVYLEQNLAAQDNVLRALTEANVQYAAVRRVLSELDQKWNSTLQTL
VASYEAYEDLMKKSQEGKDFYADLESKVATLLERAQSICRAQEAARQQLLDRELKKKAPP
PRPTAPKPLLSRREEGEAVEAGDTPEELRSLPPDMMVGPRLPDPFLGTTAPLHFSPGPFP
SSTGPATHYLSGPLPPGTYSGPTQLMQPRAAVPMAPATVLYPAPAYTSELGLVPRSSPQH
GIVSSPYAGVGPPQPVVGLPSAPPPQLSGPELAMTVRPATTTVDSVQAPISSHTAPRPNP
TPALPQPCFPVPQPVPQSVPQPQPLPVPYTYSIGTKQPLPAPYTYSIGTKQHLTGPLPQH
QFPPGIPTGFPVPRTGPQAQAQPQPQPQPQPQPQPQPQPQPQPQSQSQPQPQPQPQPQRP
AFGPQPTQQPLPFQHPHLFPSQAPGILPPPPPTPYHFTPQPGVLGQPPPTLHTQLYPGPS
QDPLPPHSGALPFPSPGPPHPHPTLAYGPAPSPRPLGPQATPVSIRGPPPASQPTPSPHL
VPSPAPSPGPGPVPSRPPTAEPPPCLRRGAAAADLLSSSPESQHGGTQPPGGGQPLLQPT
KVDAAEGRRPQALRLIEQDPYEHPERLQQLQQELEAFRGQLGDAGALDAIWRELQEAQEH
DARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRSGKDDYINASCVEGLSPYCPPLVATQA
PLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQKVARYFPTERGQPMVHGALSVALSSIR
TTETHVERVLSLQFRDQSLKRSLVHLHFPTWPELGLPDSPGNLLRFIQEVHAHYLHQRPL
HTPIVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPQLVRRMRQQRKHMLQEKLHLKF
CHEALVRHVEQVLQRHGVPPPGKPVASVNISQKNHLPQDSQDLVLGGDVPISSIQATIAK
LSIRPLGGLDSPAASLPGLVEPPGLPPASLPESTPVPSSSPPPLSSPLPEAPQPEEEPSV
PEAPSLGPPSSSLELLASLTPEAFSLDSSLRGKQRMSKQNFLQAHNGQGLRAAQPTDDPL
SLLDPLWTLNKT
Download sequence
Identical sequences Q6PB44
10090.ENSMUSP00000039580 ENSMUSP00000039580 ENSMUSP00000039580 ENSMUSP00000039580 NP_001074512.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]