SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000039663 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000039663
Domain Number 1 Region: 470-760
Classification Level Classification E-value
Superfamily Folate-binding domain 1.33e-84
Family Aminomethyltransferase folate-binding domain 0.0000316
Further Details:      
 
Domain Number 2 Region: 45-258,369-433
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-58
Family FAD-linked reductases, N-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 258-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.1e-28
Family L-aminoacid/polyamine oxidase 0.0097
Further Details:      
 
Domain Number 4 Region: 762-848
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.49e-21
Family Aminomethyltransferase beta-barrel domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000039663   Gene: ENSMUSG00000042102   Transcript: ENSMUST00000048001
Sequence length 869
Comment pep:known chromosome:NCBIM37:13:94444388:94522786:1 gene:ENSMUSG00000042102 transcript:ENSMUST00000048001
Sequence
MLRPGALRLRGLALRGSPRRPSSAGLREGQESPASPPEWKDRAETVIIGGGCVGVSLAYH
LAKAGMRDVVLMEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYERLEEETGQVV
GFHQPGSIRLATTPVRVDEFKYQMTRTNWHATEQYIIEPEKIHELFPLLNMNKILAGLYN
PGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKPRPDGTWDVETPQGSVRANRIVNA
AGFWAREVGKMIGLDHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERDGL
LFGPYESQEKMKLQASWVTHGVPPGFGKELFESDLDRISDHLEAAMEMIPVLKKADIINV
VNGPITYSPDILPMVGPHQGVRNYWVATGFGYGIIHAGGVGKFLSDWILHGEPPFDLIEL
DPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKTLKSKCSMGFH
AGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVGVIDLSPFGKFNIKGRDS
TQLLDHLFANVIPKVGFTNISHMLTPRGRVYAELTVSQQSPGEFLLITGSGSELHDLRWI
EEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSEDLSDDAFKFLQTKSFNISDI
PVTAIRISYTGELGWELYHRREDSATLYERIMSAGQEEGIGDFGTYALNALRLEKAFRAW
GSEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKTEGLKRRLVCLTVATDDVDPEGN
ESIWYKGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPATIIQEPL
VLTEPARARLQKDGKKTNLEKGPSRTTKL
Download sequence
Identical sequences Q9DBT9
ENSMUSP00000039663 ENSMUSP00000039663 NP_083048.1.92730 10090.ENSMUSP00000039663 ENSMUSP00000039663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]