SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040601 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040601
Domain Number 1 Region: 561-757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-46
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 498-590
Classification Level Classification E-value
Superfamily Fibronectin type III 6.12e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 283-344
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.9e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 2-47
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000404
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000040601
Domain Number - Region: 199-235
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00178
Family TFIIH p44 subunit cysteine-rich domain 0.055
Further Details:      
 
Domain Number - Region: 140-167
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0414
Family Cytochrome c3-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040601   Gene: ENSMUSG00000036913   Transcript: ENSMUST00000041106
Sequence length 768
Comment pep:known chromosome:NCBIM37:8:127316992:127358613:1 gene:ENSMUSG00000036913 transcript:ENSMUST00000041106
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPPPLLLSRGAAAAAT
PPDQDAAAGATSGGAGANTAGGLGGGATGGGDHADKLSLYSETDSGYGSYTPSLKSPNGV
RVLPMVPAPPGSSAAAARGAACSSLCSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEGI
VQRYQQGRGVVPGAAAAPAVAICQLCDRTPPEPAATLCEQCDVLYCATCQLKCHPSRGPF
AKHRLVQPPPPPTPPEATPAVTGTSTASSAGGCRSPGGAGASAPRKFPTCPEHEMENYSM
YCVSCRSPVCYMCLEEGRHSKHEVKPLGATWKQHKAQLSQALNGVSDKAKEAKEFLVQLK
NILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQINHCTLK
LRQSTGLMEYCLEVIKEDDPSGFLQISDALIKRVQTSQEQWVKGALEPKVSAEFDLTLDS
EPLLQAIHQLDFVQMKLPPVPLLQLEKCCTRNNSVTLAWRTPPFTHSPAEGYILELDDGD
GGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDVAWFTFDPN
SGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPAFGVARASV
VKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNKHTLTFFIN
GQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSGN
Download sequence
Identical sequences Q505D9
ENSMUSP00000040601 ENSMUSP00000040601 ENSMUSP00000130343 NP_941034.2.92730 10090.ENSMUSP00000040601 ENSMUSP00000040601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]