SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040803 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040803
Domain Number 1 Region: 66-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.27e-35
Family SPRY domain 0.005
Further Details:      
 
Domain Number 2 Region: 1252-1304
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000024
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040803   Gene: ENSMUSG00000041528   Transcript: ENSMUST00000047746
Sequence length 1320
Comment pep:known chromosome:NCBIM37:9:107954008:107981632:-1 gene:ENSMUSG00000041528 transcript:ENSMUST00000047746
Sequence
MASKGTGMSFSRKSYRLTSDAEKSRVTGIVQEKLLSDYLYRIFSPPDRGPAAATSRKPLN
FHNLPEHVDQLLQVDSEDNESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSN
FGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEGVGDTHNSYAYDGNRVRK
WNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLS
FKESVAFNFGSRPLRYPVAGFRPLQDPPFADLVRAQRLLGCFQAVLSVELDPVEGRLVET
ESSEWQLQGQPTVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGVVEKGTPEQAQSVVHQ
ILDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDLGLQIHYLRLTMSILRHEKSRKF
LLSNVLFDMLRSVVFFYIKSPLRVEEAGLKELIPTTWWPHRSSRESRDGKEAREETTEER
QRRRAYERGCQRLKKRIEVVEELQVQILKLLLDNKDDNGGEASRYIFLTKFRKFLQENAS
GRGNTPVLCPPEYMVCFLHRLVSALRFYWDEYKASNPRASFSEEAYIPPQIFYNGKVDYF
DLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQAATMDDLDEDEEPAPSAAQVWQEGQR
PMQALAIGGALPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRLLSTMEKVKVRSLNVEQ
RTREDIEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGTVMMYNLSVHQQLGKMVGVSD
DVNEYAMALRDTEDKLRRCPKRRKDILAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEK
MLDIYWLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYE
ETLTRLAAILAKHFADPRIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRIAMVRNL
LAPYEQRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDANLPSLQKPCPSTLLQQH
MADLLRQGSDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATC
FDLSVSLLRVLEMTITLVPEIFLDWSRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVT
LRLPGLESVDHYPILVAVTGILVRLLVHGPTSETEQATSVLLADPCFQLRSICYLLGQPE
PLAPGTTLPAPDRKRFSLQSYTDYISAEELAQVEQMLAHLTAASAQAAAASLPTNEEDLC
PICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVSVEDWDKAANTSAMSSAA
Download sequence
Identical sequences ENSMUSP00000040803 ENSMUSP00000125745 NP_001298081.1.92730 XP_006511940.1.92730 XP_006511941.1.92730 XP_006511942.1.92730 10090.ENSMUSP00000040803 ENSMUSP00000123933 ENSMUSP00000040803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]