SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041030 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041030
Domain Number 1 Region: 330-656
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-90
Family Protein kinases, catalytic subunit 0.0000000614
Further Details:      
 
Domain Number 2 Region: 100-186
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.3e-28
Family PB1 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 202-272
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041030   Gene: ENSMUSG00000037643   Transcript: ENSMUST00000046401
Sequence length 674
Comment pep:known chromosome:NCBIM37:3:30894669:30951659:1 gene:ENSMUSG00000037643 transcript:ENSMUST00000046401
Sequence
AWWEEPRREACCAGRREERWGSGLAAKRPLARSAPRARRVGRRGGRPRLPDRLGRPRPSR
RPALPRPPRPPAARRGSEEMPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHF
EPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSEL
LIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRI
WGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDQTMHPDHTQTVIPYNPS
SHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAM
KVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMF
HMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKE
GLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNP
DQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFF
RNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGF
EYINPLLMSAEECV
Download sequence
Identical sequences Q5DTK3
ENSMUSP00000041030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]