SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041328 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041328
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.48e-62
Family Ankyrin repeat 0.0000444
Further Details:      
 
Domain Number 2 Region: 552-621
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.3e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 483-548
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 267-346
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041328   Gene: ENSMUSG00000034471   Transcript: ENSMUST00000041684
Sequence length 1201
Comment pep:known chromosome:NCBIM37:11:115660497:115674944:-1 gene:ENSMUSG00000034471 transcript:ENSMUST00000041684
Sequence
MGREQDLILAVKNGDVTCVQKLVAKVKAAKTKLLGSTKRLNINYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKLKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLKAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGIPVARLPSAP
TPLRPSFSRISQPAADDPLPSVPYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSASEDQGLPGLHAPSPADNLSHRPLAGYRSGEIFTQDVR
PEQLLEGKDAQAIHNWLSEFQLEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKK
IASEIAQLSIAEWLPNYIPVDLLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEI
GVNKLGHQKKLMLGVKRLAELRRGLLHGEALGEGGRRMTRGPELMAIEGLENGEGPTTAG
PRLLTFQGSELSPELQAAMAGGGSEPLPLPPARSPSQESIGARSRGSGHSQEQPVPQPSV
GDPSAPQERNLPEGTERPSKLCSPLPGQGPAPYVFMCPQNLPSSPAPGPPPGVPRAFSYL
AGSPAAPPDPPRPKRRSHSLSRPGPAEGEAEGEAEGPVGSALGSYATLTRRPGRSTLART
SPSLTPTRGTPRSQSFALRARRKGPPPPPPKRLSSVSGSTEPPSLDGTSGPKEGATGPRR
RTLSEPTGPSESPGPSAPTGPVSDTEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIKQRPK
PAGPPPRETPVPPGLDFNLTESDTVKRRPKCKEREPLQTALLAFGVVGSDTPGPSNPLST
QAPCDPPSASSNPPQRSEPSVLPSQGTSASSLSSVTQSPGHPGPSAGPALANSTGSKPNV
ETEPPAPPAALLKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPENTGPVCP
GRAQQRLEQTSSSLEAALRAAEKSIGTEERDGPTGTSTKHILDDISTMFDALADQLDAML
D
Download sequence
Identical sequences Q8VHK1
ENSMUSP00000041328 ENSMUSP00000041328 10090.ENSMUSP00000041328 ENSMUSP00000041328 NP_542374.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]