SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041611 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041611
Domain Number 1 Region: 156-280
Classification Level Classification E-value
Superfamily PH domain-like 7.3e-33
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 329-423
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-24
Family SH2 domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 22-80
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.02e-20
Family Adapter protein APS, dimerisation domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041611   Gene: ENSMUSG00000042594   Transcript: ENSMUST00000040308
Sequence length 548
Comment pep:known chromosome:NCBIM37:5:122267225:122286830:-1 gene:ENSMUSG00000042594 transcript:ENSMUST00000040308
Sequence
MNEPTVQPSRTSSAPASPASPRGWSDFCEQHAAAAARELARQYWLFARAHPQPPRADLVS
LQFAELFQRHFCREVRESLAGPPGHDYRATAPPRPALPKARSSEDLGPRPACALQHLRRG
LRQLFRRRSAGELPGATSDTNDIDTTAASRPGPARKLLPWGLREPPTEALKEVVLRYSLA
DEAAMDSGARWQRGRLVLRSPGPGHSHFLQLFDPPKSSKPKLQEACSSIREVRPCTRLEM
PDNLYTFVLKVQDQTDIIFEVGDEQQLNSWLAELRASTGLGLEHPDTELPLSLAAEPGPA
RSPRGSTDSLDQGASPGVLLDPACQKTDHFLSCYPWFHGPISRVRAAQLVQLQGPDAHGV
FLVRQSESRRGEYVLTFNLQGRAKHLRLVLTERGQCRVQHLHFPSVVDMLRHFQRSPIPL
ECGAACDVRLSGYVVVLSQAPGSSNTVLFPFSLPHWDSELGHPHLSSVGCPPSHGAEALP
GQVTPPEQIFHLVPSPEELANSLRQLELESVSSARDSDYDMDSSSRGHLRAIDNQYTPLS
QLCREADV
Download sequence
Identical sequences O09039
ENSMUSP00000041611 ENSMUSP00000041611 ENSMUSP00000083490 ENSMUSP00000113926 NP_001293055.1.92730 NP_001293056.1.92730 NP_032533.1.92730 XP_006530233.1.92730 XP_006530234.1.92730 XP_006530235.1.92730 XP_006530236.1.92730 10090.ENSMUSP00000113926 ENSMUSP00000113808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]