SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041747 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041747
Domain Number 1 Region: 83-328
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.71e-41
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041747   Gene: ENSMUSG00000032715   Transcript: ENSMUST00000040312
Sequence length 354
Comment pep:known chromosome:NCBIM37:2:152163158:152169768:-1 gene:ENSMUSG00000032715 transcript:ENSMUST00000040312
Sequence
MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPASDLSP
AVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQAVLAPYARLPTHQHV
ARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLFRQMASAVAHCHKHGLVL
RDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGK
AADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEP
SERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG
Download sequence
Identical sequences Q8K4K2
10090.ENSMUSP00000041747 ENSMUSP00000041747 ENSMUSP00000041747 ENSMUSP00000041747 NP_780302.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]