SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041819 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041819
Domain Number 1 Region: 109-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-78
Family Protein kinases, catalytic subunit 0.0000147
Further Details:      
 
Domain Number 2 Region: 46-127
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-21
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000041819
Domain Number - Region: 415-483
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00247
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041819   Gene: ENSMUSG00000042724   Transcript: ENSMUST00000035987
Sequence length 1077
Comment pep:known chromosome:NCBIM37:12:82815937:82882157:-1 gene:ENSMUSG00000042724 transcript:ENSMUST00000035987
Sequence
MESSRSLLGCLASATAAPPGDDATGAGAEEEEDEEEAAAELGSHAALPYWTAVFEYEAAG
EDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGAED
PSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWAGDEVAVKAARHDPDEDISQTIEN
VRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAV
QIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKM
SAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLA
LPIPSTCPEPFAKLMEDCWNPDPHSRPSFTSILDQLTTIEESGFFEMPKDSFHCLQDDWK
HEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNII
IHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLISNRS
SPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQK
ELTSGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLMEIEDEDSEGPGSGENHQ
QHSPNQSYLCIPFPRGEDGDGPSSDGVHEEPTPVNSATSTPQLTPTNSLKRGGTHHRRCE
VALLGCGAVLAATGLGFDLLEAGKCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSP
PSRKLFKKEEPMTLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAP
PLTQCTHNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGALKPTAAPAVL
GSRSPSSNGMSPSPGTGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQRDSTLERPK
TLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSSTVEERP
GLPALLPLQAGPLLPAERTLLDLDAEGQSQDSTVPLCRAELNAHGPSPYEIQQEFWS
Download sequence
Identical sequences Q3U1V8
ENSMUSP00000041819 10090.ENSMUSP00000041819 ENSMUSP00000041819 ENSMUSP00000041819 NP_001167578.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]