SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042396 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042396
Domain Number 1 Region: 651-930
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000169
Further Details:      
 
Domain Number 2 Region: 333-503
Classification Level Classification E-value
Superfamily Fibronectin type III 4.03e-26
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 155-318
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-26
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 4 Region: 27-140
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000011
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000042396
Domain Number - Region: 528-600
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000155
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042396   Gene: ENSMUSG00000035429   Transcript: ENSMUST00000049113
Sequence length 971
Comment pep:known chromosome:NCBIM37:7:4500214:4554743:-1 gene:ENSMUSG00000035429 transcript:ENSMUST00000049113
Sequence
MARAGGNCGVWRSLVLLGLYGCSVVRAAGTSVTVDRHAPASSYEFSMWVEKDGVSSSPQI
PVTTAAPNPVRNLRVEGQNNISISLSWEPPDQSSLQGLTYWTQCSRHGGQTETRNTTDTS
VTVDGLDPGSSYECSVWVEKDGLYSKNETLNTSTAPNPVRNLRVEGQNNISISLSWEPPD
QPSLQGLTYWAQCSRHGGQTETRNTADTSVTVDGLDPGSSYECSVWVEKDGVYSTNETLN
TSTAPNPVRNLRVEGQNNISISLSWEPPDQPSLQGLTYWAQCSRHGGQTETRNTTDTSIT
VDGLDPGSSYECSVWVEKDGVYSTNETLSNTTAPNPVRNLRVKSQNNFSISLSWEPPDQP
SLQGLIYWAQCSRHGGQTETRNTTDTSVTVDGLDPGFLYKCSVWVEKDGVYSTNETLNTS
TVPISASNPVRNLRVEGQNNFSISLSWEPPDQSSLQGLTYWAQCSRHGGQTETRNTADTS
VTVDGLDPGSSYECSVWVEKDGVYSTNETLNTSTVPAAVNITSCISTSGGYGVLLTWSCP
SGGYESFEVKVGRKWRSENGSLCGKGVTVSDLEPAQSYTATVTTVFKDLKAQSLSTTCHT
ESAAIIAGAIVGILLLFILVGLLIVFLKRRRKKRQPKEVPKDLVCSCPGDILAKDFADHV
RENEKDSNCGFAEEYQQLALEGQGQSQITASALENRSKNRYRNVLPYDWSRVPLQPLQEE
PGSDYINASFMPGLWSPKEFIATQGPLPNTVGDFWRMVWEQQSHTLVMLTNCMESGRVKC
EHYWPLDAQPCIHGQLQVMLISEEASENWTVRHLQLFHMKEQQTLSLRQFHYLAWPDHGV
PYSPDPLLAFRKMLRQWMDQTTDGGPPIVHCSAGVGRTGTLIALDVLLRQLECEGLVGPF
SFVKKMRESRPLMVQTEAQYVFLHQCILKSLQKPAPALVPEEAMYENVASLVYENASAIM
AHESEFSASGC
Download sequence
Identical sequences E9Q0N2
ENSMUSP00000042396 ENSMUSP00000042396 NP_997153.2.92730 ENSMUSP00000042396 ENSMUSP00000125833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]