SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042515 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042515
Domain Number 1 Region: 11-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000776
Family Ras-binding domain, RBD 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000042515
Domain Number - Region: 100-121
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0408
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042515   Gene: ENSMUSG00000042425   Transcript: ENSMUST00000044702
Sequence length 128
Comment pep:known chromosome:NCBIM37:X:136916510:136929079:1 gene:ENSMUSG00000042425 transcript:ENSMUST00000044702
Sequence
MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMATLQDRLSLRSIEHFALVLEYT
GPEQNHKFLILQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQV
GSALGTQR
Download sequence
Identical sequences Q8BXG0
NP_808418.1.92730 ENSMUSP00000119016 ENSMUSP00000042515 ENSMUSP00000042515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]