SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000043146 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000043146
Domain Number 1 Region: 157-347
Classification Level Classification E-value
Superfamily PH domain-like 9.99e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000407
Further Details:      
 
Domain Number 2 Region: 510-614
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-24
Family SH2 domain 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000043146   Gene: ENSMUSG00000035109   Transcript: ENSMUST00000042246
Sequence length 626
Comment pep:known chromosome:NCBIM37:2:125453183:125549123:-1 gene:ENSMUSG00000035109 transcript:ENSMUST00000042246
Sequence
MRERSQDSQAGLTLYVGLFGHLGMLHRTKYSRFRNESITSLDEGSPGGSVGNKGSSPPPY
PALAPHLPTEDATVSSQESPTALCTLIPRMASMKLANPITFLGLKTFCLGTKQVSRLKLQ
ENQDQTPSRPASPESNLNRTGPAPAPDPDQVGRRPTSLRPDTCPLPGPGEPSPRSKQDGP
PLQHLLGNGLNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGAHGAIKKRK
APVKFLTTVLGKSNLQFSGMNIKLTVSTSSLTLMNLDNQQIIANHQMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTWEREEVL
VDGAPEDRDHDYYNSIPGKQPPEGGISDVRIQAQATDQMAYCPIRCEKLCYLPGNSTCSG
VYKNCMGRSRPIGIPHERAGQGDTPSLRHFWRVDLFDDPCYVNTQALQSMHSYAGNQSSA
LPQGSPWHLGKAPETVQPGATAKPGSALALPHIRQQLWDEECFHGKLSRGAAEKLLVKDG
DFLVRESVTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDNNLPI
ISSGSEVRLKQPIRKYDNTGLLPPKK
Download sequence
Identical sequences Q6S5L9
10090.ENSMUSP00000043146 ENSMUSP00000043146 ENSMUSP00000043146 ENSMUSP00000043146 NP_950187.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]