SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044165 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044165
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PX domain 1.44e-32
Family PX domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044165   Gene: ENSMUSG00000038301   Transcript: ENSMUST00000049152
Sequence length 201
Comment pep:known chromosome:NCBIM37:6:51473900:51540678:1 gene:ENSMUSG00000038301 transcript:ENSMUST00000049152
Sequence
MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWL
RQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLF
LQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEEEEGKKDADVEYDSESSSSGL
GHSSDDSSSHGCKTSPALQES
Download sequence
Identical sequences Q4FJX6 Q9CWT3
10090.ENSMUSP00000110082 mmk001003524.1 ENSMUSP00000044165 ENSMUSP00000110082 ENSMUSP00000136974 NP_001120820.1.92730 NP_001120821.1.92730 NP_082311.3.92730 XP_006506716.1.92730 XP_017177242.1.92730 ENSMUSP00000044165 ENSMUSP00000044165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]