SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044554 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044554
Domain Number 1 Region: 569-657
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-18
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-17
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000017
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 533-568
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000222
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000044554
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0392
Family Ubiquitin-related 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044554   Gene: ENSMUSG00000037712   Transcript: ENSMUST00000045905
Sequence length 680
Comment pep:known chromosome:NCBIM37:14:46078467:46149793:-1 gene:ENSMUSG00000037712 transcript:ENSMUST00000045905
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLIMPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPEILAKMFKPQ
ALLDKAKTNQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
ALLLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQ
LNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPDQITTDVNPECLVSPRYLKKYKSKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences Q3TLE2 Q8CIB5
NP_666166.2.92730 10090.ENSMUSP00000112188 ENSMUSP00000044554 ENSMUSP00000044554 ENSMUSP00000044554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]