SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045284 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045284
Domain Number 1 Region: 135-272
Classification Level Classification E-value
Superfamily ISP domain 3.67e-40
Family Rieske iron-sulfur protein (ISP) 0.000000625
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 1.77e-24
Family ISP transmembrane anchor 0.0000207
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 3.6e-21
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045284   Gene: ENSMUSG00000038462   Transcript: ENSMUST00000042834
Sequence length 274
Comment pep:known chromosome:NCBIM37:13:30632177:30637231:-1 gene:ENSMUSG00000038462 transcript:ENSMUST00000042834
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAA
ARPLVATVGLNVPASVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG
Download sequence
Identical sequences Q9CR68
NP_079986.1.92730 10090.ENSMUSP00000045284 ENSMUSP00000045284 ENSMUSP00000045284 ENSMUSP00000045284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]