SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045676 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045676
Domain Number 1 Region: 546-756
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000863
Further Details:      
 
Domain Number 2 Region: 96-368
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-33
Family FCH domain 0.038
Further Details:      
 
Domain Number 3 Region: 488-539
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000506
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045676   Gene: ENSMUSG00000036246   Transcript: ENSMUST00000036074
Sequence length 971
Comment pep:known chromosome:NCBIM37:8:72332578:72345769:1 gene:ENSMUSG00000036246 transcript:ENSMUST00000036074
Sequence
MDSAETELTPAPEGRKRYSDIFQSLDNLEISLGNVTFDPLAGDPVRREDLEPDKADTATV
VTEENSEASSWRDLSPEGPAPLTEEELDLRLIRTKGGVDAALEYAKAWSRYAKELLAWTD
KRANYELEFAKSIMKLAEAGKVSILQQSQMPLQYIYTLFLEHDLSLGALALETVAQQKRD
YYQPLAAKRMEIEKWRKEFKEQWLKEQKRMNEAVQALRRSELQYIQRREDLRARSQGSPE
DPPSQASPGSNKQQERRRRSREEAQAKAHEAEALYQACVREANSRQQDLETTKRRIVSHV
RKLVLQGDEVLRRVTLGLFELRGAQAERGPRSFSALAECCVPFEPGQRYQEFVRTLQPGA
PPPPSPAFCFQEFTAVVHSFPQDTKKKFSGPLPPRLEEEGSPEPGPWEVASLGSQGIPGS
DVDSVGGGSESRSLDSPTSSPGAGARRLVKASSTGTESSDDFEERDPDLGDGIENGVGSP
FRKWTLSTAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRR
LPARMSLFGVDFLQLPRDFPEEVPFVITRCTAEIEHRALGLQGIYRVSGSRVRVERLCQA
FENGRALVELSGNSPHDITSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGDDPGTP
NPSPEIIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAARFEENKMSANNLGIVFGPTLLRP
PDGPRATGASPVACLLDSGHQAQLVEFLIVHYEQIFGMDELPLASEPLTQDPGLAPACLE
SSPQHPASLLAQDTQPLTIALDSSPDPKHHSALEKCPEVTPPELATLQRDQREEEVEDTR
DGAGDGSSHCPEDLALGAQSRGHFSRQPVKYSRGGVRPVTHQLSSLALVASKLCEETPVT
VSAVHRGSLRVRGLGPAAACPEGSPLRRNPLPKHFEITQETARLLSKLNSDAVSRTTCCA
DPEPEESEEHL
Download sequence
Identical sequences Q6PGG2
NP_932769.1.92730 ENSMUSP00000045676 ENSMUSP00000045676 10090.ENSMUSP00000045676 ENSMUSP00000045676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]