SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045715 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045715
Domain Number 1 Region: 42-174
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-48
Family Regulator of G-protein signaling, RGS 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045715   Gene: ENSMUSG00000042671   Transcript: ENSMUST00000041776
Sequence length 180
Comment pep:known chromosome:NCBIM37:1:155500155:155544797:1 gene:ENSMUSG00000042671 transcript:ENSMUST00000041776
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWAESFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVTKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
Download sequence
Identical sequences Q8BXT1
10090.ENSMUSP00000107443 ENSMUSP00000045715 ENSMUSP00000045715 ENSMUSP00000107441 ENSMUSP00000107443 NP_080656.2.92730 XP_006529881.1.92730 XP_006529882.1.92730 XP_006529883.1.92730 XP_006529884.1.92730 ENSMUSP00000045715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]