SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045803 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045803
Domain Number 1 Region: 87-350
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.07e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045803   Gene: ENSMUSG00000031506   Transcript: ENSMUST00000049449
Sequence length 359
Comment pep:known chromosome:NCBIM37:1:137029302:137041897:1 gene:ENSMUSG00000031506 transcript:ENSMUST00000049449
Sequence
MVQACEGRSRAQLPTLSLGADMTQPPPTKAPAKKHVRLQERRGSSVALMLDVQSLGTVEP
ICSVNTPREVTLHFLRTAGHPLTRWTLQHQPPSPKQLEEEFLKIPSNFVNPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDSDYINANYIRGYDGKEKVYIATQGPMPNTVADFW
EMVWQEDVSLIVMLTQLREGKEKCVHYWPTEEEAYGPFQIRIQDMKEHPEYTVRQLTIQH
QQECRSVKHILFSAWPDHQTPESAGPLLRLVAEVETPETAANSGPIVVHCSAGIGRTGCF
IATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAAQLPPEPNP
Download sequence
Identical sequences Q8BUM3
ENSMUSP00000045803 ENSMUSP00000045803 ENSMUSP00000129474 ENSMUSP00000141133 NP_796055.1.92730 XP_006529759.1.92730 XP_006529760.1.92730 XP_006529761.1.92730 ENSMUSP00000045803 10090.ENSMUSP00000045803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]