SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000045838 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000045838
Domain Number 1 Region: 311-464
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-43
Family Dual specificity phosphatase-like 0.000061
Further Details:      
 
Domain Number 2 Region: 142-287
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.62e-24
Family Cell cycle control phosphatase, catalytic domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000045838   Gene: ENSMUSG00000039384   Transcript: ENSMUST00000048655
Sequence length 483
Comment pep:known chromosome:NCBIM37:1:185858260:185899515:1 gene:ENSMUSG00000039384 transcript:ENSMUST00000048655
Sequence
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSASPGSGSHAPVLATAVVTLKAANLTY
MPSSSGSARSLNCGCSSTSCCTVATYDKDHQAQTQAIAAGTATTAIGTSTTCPANQMVNN
NENTGSVLSPSGGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRP
FMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDEN
TNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLCDNSLQLQECREVGGG
ASAASSMLPQSVPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLP
LYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIV
IAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGME
TVV
Download sequence
Identical sequences Q9ESS0
NP_071302.2.92730 XP_006497251.1.92730 XP_006497252.1.92730 NYSGXRC-8708b 10090.ENSMUSP00000045838 ENSMUSP00000045838 ENSMUSP00000045838 ENSMUSP00000121433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]