SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046003 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046003
Domain Number 1 Region: 44-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.46e-54
Family Dual specificity phosphatase-like 0.0000000607
Further Details:      
 
Domain Number 2 Region: 199-376
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-47
Family Dual specificity phosphatase-like 0.0000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046003   Gene: ENSMUSG00000033102   Transcript: ENSMUST00000039318
Sequence length 485
Comment pep:known chromosome:NCBIM37:13:64293853:64376281:-1 gene:ENSMUSG00000033102 transcript:ENSMUST00000039318
Sequence
MKRKSERRSAWATAPPCSRRSSSSSPGVKKSRSSTPQELHRLEQQDDLYLDITDRLCFAI
LYSRPKSATNEHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIH
FTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLL
DCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY
HQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFL
DICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFL
VMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDD
EVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIWWIVCDYILPTLLFCLD
GFRTQ
Download sequence
Identical sequences Q6PFY9
NP_766175.3.92730 ENSMUSP00000046003 ENSMUSP00000105392 10090.ENSMUSP00000046003 ENSMUSP00000046003 ENSMUSP00000046003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]