SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046044 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046044
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000156
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 508-571,622-653
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000987
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000046044
Domain Number - Region: 401-494
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00114
Family Ubiquitin-related 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046044   Gene: ENSMUSG00000035172   Transcript: ENSMUST00000043397
Sequence length 796
Comment pep:known chromosome:NCBIM37:11:101023993:101032665:-1 gene:ENSMUSG00000035172 transcript:ENSMUST00000043397
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDDETFELRTPSPAGGGRGSLDVT
LTQPTRNGPISDRLQGWEETWSLIPDKGLPEEDPDIIVKGWLYREPRGGGARPWLLPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRPKETGLWSVTVSGRKHSIRLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYRRNPILRHTSS
ALYAPLLPLPYEVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
QDELFLQLAKQTSGPAGPPGLPATQDPATLRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSRRQELLCTVHCPGAGACPVSI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLTSEEA
GLEDSPDCGWRLCLRLHGPLHPEGLSPEGHELPFLFEQAHALLLRGRPPPPEDTLRALAA
LRLQSLHRDFSPRGPLPLLDRLLPPPIPPREQPPCPTRRPPPSAALLAGALWSPGLAKRR
AERARRGGTGRSTGSTAQVGGGGASTTAAVLGGWKRLRGMGQAEAMAAYLALAAQCPGFG
AARYDVLELSTEPGGGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLIGPHTL
ALRVGDSQLLLQSPQVEEIMELVNAYLANPSPERPCRSGSSSGPPSQDLPDTSPPSQHQV
LEEPQGQSGCLKQLQD
Download sequence
Identical sequences Q8VCE9
NP_666142.1.92730 10090.ENSMUSP00000046044 ENSMUSP00000046044 ENSMUSP00000046044 ENSMUSP00000046044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]