SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046639 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046639
Domain Number 1 Region: 454-762
Classification Level Classification E-value
Superfamily Folate-binding domain 1.57e-80
Family Aminomethyltransferase folate-binding domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 42-257,362-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.47e-53
Family FAD-linked reductases, N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 259-361
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.26e-19
Family L-aminoacid/polyamine oxidase 0.048
Further Details:      
 
Domain Number 4 Region: 764-857
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000311
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046639   Gene: ENSMUSG00000033624   Transcript: ENSMUST00000039333
Sequence length 878
Comment pep:known chromosome:NCBIM37:8:113618541:113660974:1 gene:ENSMUSG00000033624 transcript:ENSMUST00000039333
Sequence
MLYRLLSIVQRQRTSPGWQTWSSARSSTSTAEAHSIALPAQAQVVICGGGIMGTSVAYHL
SKMGWQDIVLLEQGRLAAGSTRFCAGILSTARHSSVEQKMANYSNKLYHQLEQETGIQTG
YLRTGSISLAQTQDRLISLKRINSRLNVVGIPSEIISPKKVAELHPLLNVHDLVGAMYVP
EDAVVSSADVALALASAASQNGVQIYDRTSVLHVLIKKGQVTGVETDKGQIECQYFVNCA
GQWAYELGLSNEEPLSIPLHACEHFYLLTRPWDTPLQSNTPTIVDADGRIYIRNWQGGIL
SGGFEKNPKPIFTEGKNQLEIQNLREDWDHFEPLLSSLLRRMPALETLEILKLVNCPETF
TPDMKCIMGESPVVQGYFVLAGMNSAGLSLGGGAGKFLAEWMVYGYPSENVWELDLQRFG
ALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEKHGFER
PKYFVPPNKDLLALEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDEA
LESLQYLFCNDLDVPVGHIVHTGMLNEYGGYENDCSIARLTKRSFFMISPTDQQVHCWAW
LNKYLPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPTLFCKEMSVGYA
NGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAF
WGQDLNTLTTPLECGGESRVKLEKGIDFIGRDALLQQKQTGVYKRLAMFILDDHDTDLDL
WPWWGEPIYRNGKYAGKTTSSAYSYTLERHVCLGYVHNFSEDSGEEQVVTTDFINRGEYE
IDIAGHRFQAKAKLYPVTSFFTHKRRKDDVELSDFHGK
Download sequence
Identical sequences Q7TSQ8
ENSMUSP00000046639 ENSMUSP00000046639 ENSMUSP00000117570 10090.ENSMUSP00000046639 NP_938050.1.92730 XP_006531147.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]