SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000046794 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000046794
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-47
Family Dual specificity phosphatase-like 0.000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000046794   Gene: ENSMUSG00000039661   Transcript: ENSMUST00000036631
Sequence length 211
Comment pep:known chromosome:NCBIM37:8:32199943:32207519:1 gene:ENSMUSG00000039661 transcript:ENSMUST00000036631
Sequence
MCPGNWLWASMTFMARFSRGSSRSPVRTRGSLEEMPSVHHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHNRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHFTLVEAIK
KVKDHRGITPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences Q9D700
NP_080145.1.92730 XP_017168431.1.92730 NYSGXRC-8685b ENSMUSP00000046794 ENSMUSP00000046794 ENSMUSP00000124949 ENSMUSP00000126397 ENSMUSP00000046794 10090.ENSMUSP00000046794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]