SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047220 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047220
Domain Number 1 Region: 667-793,988-1098
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.03e-59
Family Adenain-like 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000047220
Domain Number - Region: 227-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0492
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047220   Gene: ENSMUSG00000034252   Transcript: ENSMUST00000037484
Sequence length 1132
Comment pep:known chromosome:NCBIM37:9:79914780:79991975:1 gene:ENSMUSG00000034252 transcript:ENSMUST00000037484
Sequence
MAAGKSGGSAGALFLKALDRSESKRDGGFKNNWSFDHEEESEGDADKDGANLLSVEDEDS
EISKGKKLNRRSEIVATSSGDFILKTYVRRSKTDGFKTLKGNPIGLNMLSNNKKLSESTA
GTALCSGTVVHGRRFHHAHSQTPGIRTAAQRKEYPPYVHKAENSPVMLSHGQGGDHIMKK
TEESESYVESEIKRKVQQKRHCSTYQLSPLSPASKKCLTHLEVSEQREYCPKCGKEKENQ
TKCQSCGIVFHNDLQRNCRQAVTLNEPTGPLLRTSIHQNSGGQKSQNTGLTAKKFYGNSV
DKIPIDILVTCDDSRHNYIQTNGKVILPGGKIPKLTNPKERKISVSDLNDPIILSSDDDD
DDDDRTKRRESTSPKPADSACSSPVPSTGKVEAALNADACRAEQEPRSSPAEPELNTIVI
PRKARMKDQLGNSISTPLKRRKVNSHAAFIHPMSLSCQNFESVILNCRSIRVGTLFRLLV
EPVIFSLESITIHLDGPESDPVDIILNTSDLTKCEWCNVRKLPVVFLQAIPAVYQKLSMQ
LQMSKEDKVWNDCKGINRITSLEEQYIILIFQTGLDHQAEVVFESIITDIGIRNNVPNFF
AKILFDEANSRLVACTRSYEESIKGNCAQKENKVKTVSFESKIQLRSKQELQFFDDDEEA
GESHTIFIGPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLK
KEDADRIHIFSSFFYKRLNQRERRNPETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPL
NEAAHWFLAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNSAAK
PVIKKMLNRKHCLAVTDSSAAQEESEPCYRRNAYSVKCSMKKKNHAINENEEPSNGESTC
QDICDRTQSENGLRDECFSSVHHPDALSKIRLNYGDQSADGGKLLEDELIDFSEDQDDPD
DSSDDGLLADENYSSEIGQWHLKPTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEV
KKGSKRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFELPMNLMNWFPP
PRMKTKREEIRNIILKLQESQSKDKKLLKDSLAETSLGDGAEQYASASGGSE
Download sequence
Identical sequences Q6P7W0
NP_666115.2.92730 10090.ENSMUSP00000047220 ENSMUSP00000047220 ENSMUSP00000047220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]