SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047232 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047232
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-23
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 44-138
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000028
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000073
Family Ras-binding domain, RBD 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047232   Gene: ENSMUSG00000035615   Transcript: ENSMUST00000044773
Sequence length 1549
Comment pep:known chromosome:NCBIM37:4:45197778:45298808:1 gene:ENSMUSG00000035615 transcript:ENSMUST00000044773
Sequence
MEELDGSLSQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPPGNPAQALTPVRHTVTL
DKDVLLQNYGFHISETLPLTVVAVTAGGSAHGKLFPGDQILQMNNELAEDLSCERAADIL
RETEDALSITVVRCTSGVPKSSFLTEEKRARLKSNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKVYLENGQTKAFKFEANTTVKDIILTVKEKLSIRSIEYFALALEEQYSISRLHLLHE
EELVQQVVEREESQDSRCLFRVSFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCNSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKVFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIISTLAEFANISRVELTEESEKVSMVKVYLQDVKVLTLLLESSSAKD
LACLIAGYYRLFVDPANSVFHWSGNRRPTHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRCLVKLSLCRPFAREEQPPGDSPTPEATRRGPSTCGASSMTDSAESEASDSANTESRGC
RTSGSSESMDALEEDDLDACSSSGTSFFHFGPPGFSKGLETNSQEENSRVETSGFLCLLD
LGQNANPQCQKIDGPQGLASEACSWGPELSMGRLDPRLYEGSRTDYYNLCSSISPGSHLS
DSGSESTASRQGAAPPQWCQQGWMEAQSGSMLESLGLPALPPLAFEGGSSDEEYYDAADK
LTPPDTLSGPRAADPSAMRLQSQSRTRGSEESLHPGPEGGEPSRQGGVKKYAKSLRKRRS
FLQTDHTSQVSFPLEASASQENTDDVCYYDREPYLTLTAPSPTVSSLQDMQGEPGLLETK
ALGLLASLRETKSTNPASRIMEMEPETMETKSVIDSRVSSISAIRLRIDPSNTENPVTTD
GSSASIPHSPHHSNPGSSSPQAAQVRPFPIVSPDQDPGGTTPKELTAEPEDSTFPLSSDH
PNPDNPGPHHVSQGDTSELGEVRSEIGSESFLINHVQEVIPQITGPLCPGDGPTSGECEV
NSEETALAADEVQGQLSLDSDREVMHRNGPSLFQKGSGKDLGDSKGDRLDNVPQALDVRA
PAGEINSSLCSEPPATGTGQTSSDSEGENREAQEQELLTELDLAPDFLLPSAFPPETIKA
EQLDRVIGEDSVPVSTSQQVCVHTVPSLPKLSPCQEEPRSADSGHGSPAESKGDDSPIIC
LPPERSFLCFAPESHPEGSTSLSRVTSFSFAGINEVAPAEIGIEHCRCQFSYATCFRGLQ
PETEEEDGDPQTHPAAPLTSPPSAGSQVTLPWRAARAYSCTTPLSRKSHIWPEFCSRALR
QLKTTPTNAPEGFVQLTESLLELQDILEASWGVGNKHPPDKCTLHFSESRSRLCMGSQKL
LASCQHVIRMDQSPEEMQGAVRVTFQHLVQLAGLCFQFTDCSRCSTRHREVAGNLRDVVY
TYHQFVEAAKLTCERGYHDFSVKLLARQCTALTAAVFCLTQKFRASTAL
Download sequence
Identical sequences A2AKB4
ENSMUSP00000047232 10090.ENSMUSP00000047232 ENSMUSP00000103434 NP_001074641.1.92730 XP_006538238.1.92730 XP_006538239.1.92730 XP_006538240.1.92730 XP_006538241.1.92730 XP_011248387.1.92730 ENSMUSP00000047232 ENSMUSP00000103434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]