SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047403 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047403
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-26
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-24
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.0000141
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047403   Gene: ENSMUSG00000038175   Transcript: ENSMUST00000038275
Sequence length 445
Comment pep:known chromosome:NCBIM37:13:45485111:45507388:1 gene:ENSMUSG00000038175 transcript:ENSMUST00000038275
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKESLLAGHLQCSPEQAVELS
ALLAQTKFGDYNQNTAQYSYEDLCEKELSSSTLNSIVAKHKELEGISQASAEYQVLQIVS
AMENYGIEWHAVRDSEGQKLLIGVGPEGISICKEDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSDQSPPSSPLKSSDSSMSC
SSCEGLSCQQTRVLQEKLRKLKEAMLCMACCEEEINSTFCPCGHTVCCESCAAQLQSCPV
CRSRVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences Q8BM54
NP_722484.2.92730 ENSMUSP00000047403 10090.ENSMUSP00000047403 ENSMUSP00000047403 ENSMUSP00000047403 MmR37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]