SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048057 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048057
Domain Number 1 Region: 407-731
Classification Level Classification E-value
Superfamily DNase I-like 2.09e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 20-117
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-26
Family SH2 domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1192-1255
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000314
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048057   Gene: ENSMUSG00000032737   Transcript: ENSMUST00000035836
Sequence length 1257
Comment pep:known chromosome:NCBIM37:7:108971147:108986740:-1 gene:ENSMUSG00000032737 transcript:ENSMUST00000035836
Sequence
MASVCGTPSPGGALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGE
REPDPPDDRDASDVEDEKPPLPPRSGSTSISAPVGPSSPLPTPETPTTPAAESTPNGLST
VSHEYLKGSYGLDLEAVRGGASNLPHLTRTLVTSCRRLHSEVDKVLSGLEILSKVFDQQS
SPMVTRLLQQQSLPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPLQP
SIRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTF
THDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNRHSKQD
EPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKALDEVTVTIPHDIYVFGTQENSVGDR
EWLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLG
NKGAVGVSFMFNGTSFGFVNCHLTSGNEKTTRRNQNYLDILRLLSLGDRQLSAFDISLRF
THLFWFGDLNYRLDMDIQEILNYISRREFEPLLRVDQLNLEREKHKVFLRFSEEEISFPP
TYRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHS
PVFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKK
SFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVV
ALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDDTGAK
SKVPSVSRGSQEHRSGSRKPASTETSCPLSKLFEEPEKPPPTGRPPAPPRAVPREEPLNP
RLKSEGTSEQEGVAAPPPKNSFNNPAYYVLEGVPHQLLPLEPPSLARAPLPPATKNKVAI
TVPAPQLGRHRTPRVGEGSSSDEDSGGTLPPPDFPPPPLPDSAIFLPPNLDPLSMPVVRG
RSGGEARGPPPPKAHPRPPLPPGTSPASTFLGEVASGDDRSCSVLQMAKTLSEVDYAPGP
GRSALLPNPLELQPPRGPSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAGM
GAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Download sequence
Identical sequences Q6P549
NP_001116211.1.92730 NP_034697.2.92730 XP_006507454.1.92730 XP_011239984.1.92730 XP_017177480.1.92730 ENSMUSP00000048057 ENSMUSP00000048057 ENSMUSP00000132883 10090.ENSMUSP00000048057 ENSMUSP00000048057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]