SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048119 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048119
Domain Number 1 Region: 2141-2436
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.94e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000143
Further Details:      
 
Domain Number 2 Region: 658-766
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-33
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 3 Region: 1066-1174
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-28
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 4 Region: 1339-1446
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-27
Family PDZ domain 0.0000318
Further Details:      
 
Domain Number 5 Region: 768-874
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-27
Family Third domain of FERM 0.0029
Further Details:      
 
Domain Number 6 Region: 1758-1847
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-21
Family PDZ domain 0.015
Further Details:      
 
Domain Number 7 Region: 1477-1585
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-20
Family PDZ domain 0.05
Further Details:      
 
Domain Number 8 Region: 1851-1942
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-19
Family PDZ domain 0.012
Further Details:      
 
Domain Number 9 Region: 564-657
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-16
Family First domain of FERM 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000048119
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00731
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048119   Gene: ENSMUSG00000034573   Transcript: ENSMUST00000048957
Sequence length 2451
Comment pep:known chromosome:NCBIM37:5:103854211:104027378:1 gene:ENSMUSG00000034573 transcript:ENSMUST00000048957
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQEVFRRVSIADPAALGFIISPWSLLLLP
SGSVSFTDENVSNQDLRAFTAPEVLQSHSLTSLADVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNI
SGTDPLSRSSEQKPDRSQAIRDRLRGKGLPTGRSSTSDALDTHEAPLSQQTFLNKGLSKS
MGFLSIRDTRDEEDYLKDTPSDNNSRHEDSETFSSPYQFKTSTPQMDALSKKKTWASSMD
LLCAANRDISGETGRYQRCDPETVTGRTSITPRKKEGRYSDGSIALDIFGPQKVEPVIHT
RELPTSTAVSSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHSDIFSISSESPSVISSE
SDFRQVRKSEASKRFESSSGLPGVDETGQTRPSRQYETSLEGNLINQDIMLRRQEEEMMQ
LQARMALRQSRLSLYPGDTVKASMLDISRDPLREMALETAMTQRKLRNFFGPEFVKMTVE
PFVSLDLPRSILSQTKKGKSEDQRRKVNIRLLSGQRLELTCDTKTICKDVFDMVVAHIGL
VEHHLFALATRKENEYFFVDPDLKLTKVAPEGWKEEPKRKGKAAVDFTLFFRIKFFMDDV
SLIQHDLTCHQYYLQLRKDLLDERVHCDDEAALLLASLALQAEYGDYQPEVHGVSYFRLE
HYLPARVMEKLDVSYIKEELPKLHNTYAGASEKETELEFLKVCQRLTEYGVHFHRVHPEK
KSQTGILLGVCSKGVLVFEVHNGVRALVLRFPWRETKKISFSKKKITLQNTSDGIKHAFQ
TDSSKACQYLLHLCSSQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRGFNMGRAI
STGSLASSTINKLAVRPLSVQAEILKRLSSSEWSLYQPLQNSSKEKTDKASWEEKPRGMS
KSYHDLSQASLCPHRKQVINMEALPQAFAELVGKPLYPMARSDTESLAGLPKLDNSKSVA
SLNRSPERRNHESDSSTEDPGQAYVVGMSLPSSGKSSSQVPFKDNDTLHKRWSIVSSPER
EITLVNLKKDPKHGLGFQIIGGEKMGRLDLGVFISAVTPGGPADLDGCLKPGDRLISVNS
VSLEGVSHHAAVDILQNAPEDVTLVISQPKEKPSKVPSTPVHFANGMKSYTKKPAYMQDS
AMDPSEDQPWPRGTLRHIPESPFGLSGGLREGSLSSQDSRTESASLSQSQVNGFFASHLG
DRGWQEPQHSSPSPSVTTKVNEKTFSDSNRSKAKRRGISDLIEHLDCADSDKDDSTYTSS
QDHQTSKQEPSSSLSTSNKTSFPTSSASPPKPGDTFEVELAKTDGSLGISVTGGVNTSVR
HGGIYVKAIIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEK
GQVPTSRERDPAGPQSPPPDQDAQRQAPEKVAKQTPHVKDYSFVTEDNTFEVKLFKNSSG
LGFSFSREDNLIPEQINGSIVRVKKLFPGQPAAESGKIDVGDVILKVNGAPLKGLSQQDV
ISALRGTAPEVSLLLCRPAPGVLPEIDTTFLNPLYSPANSFLNSSKETSQPSSSVEQGAS
SDDNGVSGKTKNHCRAPSRRESYSDHSESGEDDSVRAPAKMPNVTRVAAFPHEAPRSQEE
SICAMFYLPRKIPGKLESESSHPPPLDVSPGQTCQPPAECAPSDATGKHFTHLASQLSKE
ENITTLKNDLGNHLEDSELEVELLITLVKSEKGSLGFTVTKGSQSIGCYVHDVIQDPAKG
DGRLKAGDRLIKVNDTDVTNMTHTDAVNLLRAAPKTVRLVLGRILELPRMPVFPHLLPDI
TVTCHGEELGFSLSGGQGSPHGVVYISDINPRSAAAVDGSLQLLDIIHYVNGVSTQGMTL
EDANRALDLSLPSVVLKVTRDGCPVVPTTRAAISAPRFTKANGLTSMEPSGQPALMPKNS
FSKVNGEGVHEAVCPAGEGSSSQMKESAGLTETKESNSRDDDIYDDPQEAEVIQSLLDVV
DEEAQNLLNQRHATRRACSPDPLRTNGEAPEEGDTDYDGSPLPEDVPESVSSGEGKVDLA
SLTAASQEEKPIEEDATQESRNSTTETTDGEDSSKDPPFLTNEELAALPVVRVPPSGKYT
GTQLQATIRTLQGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYDTTR
VPLGDEGGYINASFIRIPVGTQEFVYIACQGPLPTTVGDFWQMVWEQNSTVIAMMTQEVE
GEKIKCQRYWPSILGTTTMANERLRLALLRMQQLKGFIVRVMALEDIQTGEVRHISHLNF
TAWPDHDTPSQPDDLLTFISYMRHIRRSGPVITHCSAGIGRSGTLICIDVVLGLISQDLE
FDISDLVRCMRLQRHGMVQTEGQYVFCYQVILYVLTHLQAEEQKAQPGLPQ
Download sequence
Identical sequences G5E8B1
ENSMUSP00000048119 ENSMUSP00000048119 NP_035334.2.92730 ENSMUSP00000048119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]