SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049393 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049393
Domain Number 1 Region: 1982-2278
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-125
Family BEACH domain 0.00000000808
Further Details:      
 
Domain Number 2 Region: 2398-2673
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.18e-28
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 1881-1977
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-26
Family PreBEACH PH-like domain 0.0043
Further Details:      
 
Domain Number 4 Region: 11-537,861-884,925-1119,1148-1166
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-18
Family Plakophilin 1 helical region 0.09
Further Details:      
 
Domain Number 5 Region: 569-719
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000018
Family Laminin G-like module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049393   Gene: ENSMUSG00000073664   Transcript: ENSMUST00000035569
Sequence length 2688
Comment pep:known chromosome:NCBIM37:1:60237443:60391549:1 gene:ENSMUSG00000073664 transcript:ENSMUST00000035569
Sequence
MAARERLFELWMLYCTKKDPDYLRLWLDNFVLSYEQFLDVDFEKLPTRVDDMPPGISLLP
DNILQVLRIQLLHCVQKTADGLEEQQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVI
TMTTLYIQQLKSKKKEKEMADQTSIEEFVIHALAFCESLYDPYRNWRHRISGRILSSVEK
SRQKYKPASLTVEFVPFFYQCFQESEHLKDSLKCCLLHLFGAIVAGGQRNALQAISPATM
EVLMRVLSDCDSWEEGDPEEVGRKRELTLKCLTQVVHILLTSSSDQRQVETSTILENYFK
LLNSDHSALPKQGRSRRWESQFIALQIKMLNTITSMLDCTDRPVLQAIFLNSNCFEHLIR
LLQNCKVFQGQLDCLAVSAIQALTAVMKSSPAAKEVFKERIGYMHMFEVLKSLGQPPQEL
LKELMNMAVEGDHTSVGILGISNVQPLLVLIQWLPELESHDLQIFVSDWLKKICCINKQS
RTTCVNANMGIKIIEALESHSSLHRTCAENLIAIHGSLGSQSVSSEEIRRLLRLLRVDES
ECIHPYTIPVTRAVLTMARKLSFESALQYFNLSHSMAGISVPAIQRWPGSAFSFTAWFCL
DQDPLTLGSANKGGKRKQLYSFFTGSGMGFEAFITHSGVLVVAVCTKREYATVMLPDHSF
CDSLWHNITIVHMPGKRPFGQSLVYIYDNGQQKVSAPLRFPAMNEPFTSCCIGSAGQRTT
TPPPSQIPDPPFSTPITPHRTSFGGILSSASWGGTIEKSKLFTKLISAGTQDSEWGCPTS
LEGQLGSVIIFHEALQPPQVKALYLAGPNCLSPWKCQDCDMADLPSNILLHYTGKACKNS
ICLDLSANCLHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISHFSEGQTSEAMSENT
VPELVTPSEQECMGLASTRASESRLEKNLIATFILIVKHFIQRHPINQDNLIQSHGVATL
GALLQKVPGSQMDVNVLMAIQLLIEQVSLEKNTLLLQQMYQCLLFDFRIWNRGDFPFQIG
HIQYLSTIIKDSRRVFRKKYGVQFLLDTLRIYYGHGSTCNELSPDDIRTIRTSLYGLIKY
FLCKGGTHEEIQSIIGYIAATNEEEQLFGILDILFSLLRTSPTRGQLFLLLFEPGNADIL
YALLLNQKYSDKLREIIFKVMEQMLKCTNVYERSKQRIRLREVGYSGIGLLLNEAPVNTS
LIKNLVNQIINTDPVINFKDLLSVVYICHRTHVNVRVVLCRKILQILQSQPDAAYQISQQ
VGWQDTFVRLFLKANFENVNSLNKHGKTVSMKENKNMSTEDVKRNFEKLDDEKMMLADVS
SDHWSLEDSQSLNSNTPLFQEDSSEGELSFKSENQEEFWHSNTSHLSLDLSGIDACELSD
SGSQVPDSSPSTPSPVESTKSFSLQSDKERSITNEMGFSDDFSFLESQERCEEELFQLLT
NILNYVMCKGLEKSDEDTWIERGQVFSALTKPGISSELLRPSDEVKLTLLQKMLEWAITE
NRDAKSSPVTAENAFRLMLIVQDFLQSEGLVNSNMWTEKLLEDATQLLDCLSVWYSENPA
WVKLSQIQTQLLLEFIGRGSLQVCAMASAKLNALLQTKVIENQDEACYILGKLEHILSRS
IKEQTEIYSFLIPLLRTLVSKIYELLFMNLHLPSLPFTNGSASFFEDFQEYCNSEEWQVY
IEKYIVPYMKQYEAHTFYDGHENMALYWKNCYEALMVNMHKRDREGGESKLKFQEYFVEP
FNRKARQENLRYNNMIKQLNSQQLAAVRRWKAIRLYLTCERGPWAEKKQNRIHWKLANVE
NYSRMRLKLVPNYNFKTHEEASALRDNLGVQHLQPSSDSLLLEVVKQVKLSDMEEDKLEL
LEEDMAARVNIDEKEEQNQKEKLVLTEDCELITVIDIIPGRLEVTTQHIYFHDNSVEKED
GLGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKIYSRLLSLHSP
TGYGTRSPQELFKASGLTQKWVNREITNFDYLIQINTMAGRTYNDLAQYPVFPWILQDYT
SEELDLNNPTVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHYGTHYSNSAGVM
HYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNTYDVKELIPEFFYFPEFLE
NQNEFNLGHLQVSKELVNDVILPRWAKSAEDFIYKHRKALESEYVSAHLHEWIDLIFGYK
QRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEPHPPRLS
AEEAIQKQTKTEISTLNLFQHLTELKSFFIEGISDGIPLLKAIIPKNQSRSFMSQGSPEL
LITVSMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKAQRTISGPFAPGLEITSKLFVV
SHDAKLLFSAGHWDNSIQVMSLTKGKIVSHNIRHIDIVTCLATDYCGIHLISGSRDTTCM
IWQITQQGGTPVGLAPKPFQILYGHTDEILSVGISTELDMAVSGSRDGTVIIHTVQKGQY
MRTLRLPCESSLFLTIPSLAISWEGHIVVYSSLEEKSVLKDKNLLHLFSINGKYLGSQVL
SEQISDMCIIGEHIITGSLQGLLSIRELHSLKLSVTPLAMRLPIHCVSITKEYSHILVGL
EDGKLIVVGVGKPAEMRSGQLSRKLWGSSKRLSQISAGETEYNTQDCK
Download sequence
Identical sequences E9PYP2
NP_775620.2.92730 ENSMUSP00000049393 ENSMUSP00000049393 ENSMUSP00000124056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]