SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049414 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049414
Domain Number 1 Region: 149-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.16e-39
Family Dual specificity phosphatase-like 0.0000651
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 9e-24
Family Cell cycle control phosphatase, catalytic domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049414   Gene: ENSMUSG00000037887   Transcript: ENSMUST00000039926
Sequence length 663
Comment pep:known chromosome:NCBIM37:7:149265395:149281177:-1 gene:ENSMUSG00000037887 transcript:ENSMUST00000039926
Sequence
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSCHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPATRSQVDATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPATLPSMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKD
LMTQNGISYVLNASNSCPKPDFICESRFMRIPINDNYCEKLLPWLDKSIEFIDKAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
KLLAALQTDGPHLGTPEPLMGPAAGIPLPRLPPSTSESAATGSEAATAAREGSPSAGGDA
PIPSTAPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDFPGPPDPGE
APKLCKLDSPSGGTLGLPSPSPDSPDSVPECRPRPRRRRPPASSPARSPAHGLGLNFGDT
ARQTPRHGLSALSAPGLPGPGQPAGPGGWVPPLDSPGTPSPDGPWCFSPEGAQGPGAVFS
AFGRVSAGAPGPGNSSSSGGGGGGGGGGGGGGGGGGSSSSNSSSSSSSSSSSSSSSSSSS
DLRRRDVRTGWPEEPAADAQFKRRSCQMEFEEGMVEGRARGEELAALGKQTSFSGSVEVI
EVS
Download sequence
Identical sequences O09112
NP_032774.1.92730 XP_006508572.1.92730 XP_011240291.1.92730 ENSMUSP00000049414 ENSMUSP00000049414 NYSGXRC-8654b ENSMUSP00000049414 10090.ENSMUSP00000049414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]