SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049460 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049460
Domain Number 1 Region: 469-532,569-666
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-31
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 673-800
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-21
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 1087-1219
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-18
Family Second domain of FERM 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000049460
Domain Number - Region: 14-127,574-594
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000115
Family BAR domain 0.067
Further Details:      
 
Domain Number - Region: 988-1065
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00331
Family Ubiquitin-related 0.05
Further Details:      
 
Domain Number - Region: 1222-1282
Classification Level Classification E-value
Superfamily PH domain-like 0.00615
Family Third domain of FERM 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049460   Gene: ENSMUSG00000060716   Transcript: ENSMUST00000039928
Sequence length 1356
Comment pep:known chromosome:NCBIM37:12:80130150:80182635:1 gene:ENSMUSG00000060716 transcript:ENSMUST00000039928
Sequence
MAEVKVEVASIDWQKRCLSLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAE
TQVGVMEEKIKLSNLKSVDSTGTLHQKYQELLRAVQGKDELISQLQAQLEKQKQTRAEEA
KIVQEKAAKIKEWVTVKLAELEMENQQLKTCNQQLVEQVAALQDALEDLRMTPSEELLVV
PEGTPERDPVPSGPSDQPVEQDSNPHTQILKVAVPTPSLGTLQSRDSLSEARSLEDLRFS
MVHPGETAEAKTLQSHLQKEGSPSQLCMKPGNPKHGSASYRESLVTAQGGTFPGTKTSAR
EGGPGSSLTLPKVRAPSIPRDSFQVAKRHHSQPQVGPGHCDHVVSIEIGALSALHSPGSS
KSEARAKVREEAEKMEMEALPPSGKQEERESLKSRRGELEDVELENKPPTPPLHRFPSWE
SRIYAMATSGMQLSEVSSRRSNAACYASGPSALAFPGAFSGLVYKNVTVPVYTALKGKAT
QISNVPFVDESSGSDDDCGSQASFRMSVPCSEYRKTSGLGSPRAIKRGVSMSSLSSEGDY
AIPPDACSLDSDYSEPEHKLQRTSSYSTDGEALEKSGYLLKMGSRVKTWKRRWFVLRQGQ
ILYYKSPSDVIRKPQGQVDLNSHCQIVREEEAQTFQLISGNKTYYLTAESPSLLEEWIRV
LQSLLKVQVTGPPALHQGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPL
GCLPVQDAHIEEVDRSCDSDEDYEAGGTGRLLSSHCTLVIHPPEHSPTYLLIGTKHEKDT
WLYHLTVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPS
EALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQIS
CRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYAIYCQRAVER
TLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRL
NQETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKELHPGKSEGGTR
VVKLMYKNRLYFRSQVKGETERERLLLAFQASGEIVAGRFPVTKELALEMAALMAQVEYG
DLEKPTLPGPGGTPPTKAQHLLQQVLDRFYPRRYRNGAPPEQLRHLADMMATKWAALQGC
SPPECIRIYLTVARKWPLFGAKLFAAQPAQLSPKENTVVWIAVNEDGVSILDHRTMQVNI
TYPYSSVTTFGGCRDDFMLVIRSIPDQSSGKTRIDKLTFRMPAPKITETTLMMASYMNHC
SATVNLSAKLPAARQPRDLDGQFFASVSCTKGSALL
Download sequence
Identical sequences Q80TI1
NP_851418.2.92730 XP_006515708.1.92730 ENSMUSP00000049460 ENSMUSP00000049460 10090.ENSMUSP00000049460 ENSMUSP00000049460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]