SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050267 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050267
Domain Number 1 Region: 283-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-66
Family SPRY domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 3-83
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-21
Family RING finger domain, C3HC4 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050267   Gene: ENSMUSG00000031651   Transcript: ENSMUST00000059692
Sequence length 470
Comment pep:known chromosome:NCBIM37:8:44215161:44226840:-1 gene:ENSMUSG00000031651 transcript:ENSMUST00000059692
Sequence
MSNHEKMSTTDLMENLREELTCFICLDYFSSPVTTECGHSFCLMCLLKSWEEHNTPLSCP
ECWRTLGAPHFQANERLGRLANIGRQLRSQVLQSEDEQSICGRMPGPSWVFSDDEQSVIN
VSPPSQGTNKACFSSEAEEQHKEKLQDIINILRKKKKEVQAILNHEKERVMLCKEETKTC
KQVVVSEYMKMHQFLKEEEQLQLQLLEREEKANMKKLRENEIQLTQQIRRLGKMIGRIES
TCQNLTLESFEEVKGAMDRYESLLFQSPETTITELSLCHITGMREMLRKFSTDITLDPAT
ANAYLLLSEDLKSVRYGGTRQQLPDNPERFDQSATVLGAQIFTCGRHYWEVEVGKKTEWE
VGICKDSVNRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVHKVGVFLDYD
SGHIAFYNATDESLIYSFPPTPFHEALRPIFSPCLPNEGTNTDPLIICHI
Download sequence
Identical sequences Q8BVP1
ENSMUSP00000050267 NP_808410.1.92730 ENSMUSP00000050267 ENSMUSP00000050267 10090.ENSMUSP00000050267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]