SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051216 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051216
Domain Number 1 Region: 153-310
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-27
Family Dual specificity phosphatase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 3-82,115-181
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000416
Family Cell cycle control phosphatase, catalytic domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051216   Gene: ENSMUSG00000019178   Transcript: ENSMUST00000053906
Sequence length 321
Comment pep:novel chromosome:NCBIM37:5:136223090:136254108:-1 gene:ENSMUSG00000019178 transcript:ENSMUST00000053906
Sequence
MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRDHQY
LIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEF
GQILIHFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGK
ISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFI
ELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQ
LLEWEKVLHGEYLTDISEPIY
Download sequence
Identical sequences Q9DAR2
NP_001276483.1.92730 NP_001276484.1.92730 NP_083935.3.92730 10090.ENSMUSP00000106794 ENSMUSP00000051216 ENSMUSP00000051216 ENSMUSP00000051216 ENSMUSP00000106793 ENSMUSP00000106794 ENSMUSP00000135982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]