SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051246 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051246
Domain Number 1 Region: 14-147
Classification Level Classification E-value
Superfamily PX domain 1.06e-21
Family PX domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051246   Gene: ENSMUSG00000021411   Transcript: ENSMUST00000053459
Sequence length 231
Comment pep:known chromosome:NCBIM37:13:34719709:34744540:-1 gene:ENSMUSG00000021411 transcript:ENSMUST00000053459
Sequence
MASAVFEGTSLVNMFVRGCWVNGIRRLIVSRRGDEEEFFEIRTEWSDRSVLYLHRSFADL
GRLCKRLRDAFPEDRSELARTPLRQGLLAIKGAHDIETRLNEVEKLLETVISMPCKYSRS
EVVLTFFERSPLDQVLKNDNVHKIQPSFQSPVKISEIMRSNGFCLANTETIVIDHSIPNG
KDQLLDADSTEHLFENGGEFTSELEDGDDPEAYVTNLSYYHLVPFETDILD
Download sequence
Identical sequences Q8JZU6
ENSMUSP00000051246 ENSMUSP00000051246 NP_080107.3.92730 ENSMUSP00000051246 10090.ENSMUSP00000051246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]