SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000051331 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000051331
Domain Number 1 Region: 70-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-37
Family Regulator of G-protein signaling, RGS 0.00000538
Further Details:      
 
Domain Number 2 Region: 760-840
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.54e-27
Family DIX domain 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000051331   Gene: ENSMUSG00000000142   Transcript: ENSMUST00000052915
Sequence length 840
Comment pep:known chromosome:NCBIM37:11:108781663:108812097:1 gene:ENSMUSG00000000142 transcript:ENSMUST00000052915
Sequence
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGVPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHQHHHHQQCH
TLLPTGGKLPPVAACPLLGGKSFLTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRCL
CPGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTLPKRNAKGTEPGLALSARDGGMSSA
AGAPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESACAAPGERVSRHHL
LGASGHSRSVARAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRD
RNHSAAGQAGASPFANPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKA
QSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
Download sequence
Identical sequences O88566
ENSMUSP00000051331 NP_056547.3.92730 XP_006532120.1.92730 XP_006532121.1.92730 XP_006532122.1.92730 XP_006532123.1.92730 10090.ENSMUSP00000051331 ENSMUSP00000051331 ENSMUSP00000051331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]