SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052202 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052202
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-28
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 229-369
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-25
Family Third domain of FERM 0.0039
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000116
Family First domain of FERM 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052202   Gene: ENSMUSG00000048285   Transcript: ENSMUST00000057859
Sequence length 622
Comment pep:known chromosome:NCBIM37:12:71926501:72003219:1 gene:ENSMUSG00000048285 transcript:ENSMUST00000057859
Sequence
MNKLTFHNNKAMQDRRRVCIFLPNDKSVSIIINVKILCHQLLVQVCDLLRLKDSHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
KLISDRIARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRKLHHGDYFEPE
AYFPAWVVSKRGKDYILKHIPNMHKDQFALTASEAYLKYIKEAVRLDDVAIHYYRLYKDK
REAEGSLTLGLTMRGIQIFQNLEEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
VYYTGCPTRSRHLLQLLSNSHRLYMNLQPVLRHLRKQEENEEKKQYRESYISDNLDLDMD
PLEKRSRASGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDPGPEDSCSGSAMHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDEEIEMLVDDPRDLEPMPEESLEVSPEMC
IYITEDMLLSRKLNGHSGLIVKEIGSSTSSSSETVVRLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDESGLYCNSCLAQQCVNIQDAFP
VKRASKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences Q8C0V9
ENSMUSP00000052202 10090.ENSMUSP00000052202 ENSMUSP00000052202 ENSMUSP00000052202 NP_082403.2.92730 XP_006516040.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]