SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052625 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052625
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-25
Family SH2 domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000051
Family SOCS box-like 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052625   Gene: ENSMUSG00000050974   Transcript: ENSMUST00000052528
Sequence length 198
Comment pep:known chromosome:NCBIM37:12:14501367:14501963:1 gene:ENSMUSG00000050974 transcript:ENSMUST00000052528
Sequence
MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTIFVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences ENSMUSP00000052625 10090.ENSMUSP00000052625 ENSMUSP00000052625 ENSMUSP00000052625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]