SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052776 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052776
Domain Number 1 Region: 61-187
Classification Level Classification E-value
Superfamily PH domain-like 5.69e-51
Family Phosphotyrosine-binding domain (PTB) 0.0000629
Further Details:      
 
Domain Number 2 Region: 531-603
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000013
Family SH3-domain 0.0000359
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000052776
Domain Number - Region: 725-778
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000356
Family Pointed domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052776   Gene: ENSMUSG00000015766   Transcript: ENSMUST00000058210
Sequence length 821
Comment pep:known chromosome:NCBIM37:6:137425766:137597806:-1 gene:ENSMUSG00000015766 transcript:ENSMUST00000058210
Sequence
MNGHMSNRSSGYGVYPSQLNGYGSSPPYSQMDREHSSRTSAKALYEQRKNYARDSVSSVS
DVSQYRVEHLTTFVLDRKDAMITVEDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLE
SKNELENFPLNTISHCQAVVHACSYDSILALVCKEPTQSKPDLHLFQCDEVKANLISEDI
ESAISDSKGGKQKRRPEALRMIAKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSAWA
ADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKR
KKSKKSKRKGPGEGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLVHF
LFTPLNMVVQATGGPELASSVLSPLLTKDTVDFLNYTATAEERKLWMSLGDSWVKVRAEW
PKEQFIPPYVPRFRNGWEPPMLNFMGAPTEQDMYQLAESVANAEHQRKQDSKRLSTEHSN
VSDYPPADGYAYSSSMYHRGPHADHGEAAMPFKSTPNHQVDRNYDAVKTQPKKYAKSKYD
FVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPESGVGRADPP
YTHTIQKQRTEYGLRSADTPSAPSPPPTPAPVPVPLPPSVPAPVSVPKVPANVTRQNSSS
SDSGGSIVRDSQRYKQLPVDRRKSQMEEVQDELFQRLTIGRSAAQRKFHVPRQNVPVINI
TYDSSPEEVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRSVCPEGARVFNQITVQK
AALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences Q08509
ENSMUSP00000052776 ENSMUSP00000098402 ENSMUSP00000107509 ENSMUSP00000052776 ENSMUSP00000052776 NP_001258517.1.92730 NP_001258524.1.92730 NP_031971.2.92730 XP_011239506.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]