SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053157 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053157
Domain Number 1 Region: 320-407
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.47e-19
Family SAM (sterile alpha motif) domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053157   Gene: ENSMUSG00000044770   Transcript: ENSMUST00000063063
Sequence length 408
Comment pep:known chromosome:NCBIM37:10:42580176:42680586:1 gene:ENSMUSG00000044770 transcript:ENSMUST00000063063
Sequence
MQTQRVPGRKRGRPPLHSTRVQMAVHNLYSASAASVPAVTIPKKRGRKPRYKIKSPVLMT
PLALSPPRSTPEPDLSSIPQDAATIPSLVVPEALTVCLYINKQADVGPYLERRKLQQLPE
RLGPERPATVLQQAVQACIDCAHQPRLVFSLVKQGYRGELVSVSASFDGKQHLRSLPVVN
SVGYVLRFLTKLCRSLLCDNLFSHLPFPGSIGASDKAQEREDGRTESAKVATAEECLANA
VGMNRYAMDFSHRGSVTHSSSLYKRLTCGDSHLAGGPATTTSGSRTNPVPSGGSSSPGLR
LPASSPKRNGTAIEGNRCAPSPSPEVQDTRRPSSRNPSTWTVEDVVRFVKDADPEALGPH
VELFRKHEIDGNALLLLRSDMIMKYLGLKLGPALKLCYHIDKLKQAKF
Download sequence
Identical sequences Q80VG1
ENSMUSP00000053157 ENSMUSP00000053157 ENSMUSP00000053157 NP_766526.3.92730 10090.ENSMUSP00000053157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]