SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000053232 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000053232
Domain Number 1 Region: 928-1120
Classification Level Classification E-value
Superfamily Bet v1-like 5.59e-60
Family STAR domain 0.0000000081
Further Details:      
 
Domain Number 2 Region: 676-887
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00068
Further Details:      
 
Domain Number 3 Region: 48-122
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.5e-33
Family Variant SAM domain 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000053232   Gene: ENSMUSG00000016128   Transcript: ENSMUST00000062015
Sequence length 1132
Comment pep:novel chromosome:NCBIM37:5:151840203:151992769:-1 gene:ENSMUSG00000016128 transcript:ENSMUST00000062015
Sequence
MFSQVPRTPAAGCYYLNPLTPESQEMYLRFDQTARRSPYRMSRILARHHLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIAAVKKDHDFLERDLVEPLCRRLNTLNKCASMR
LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLHTLFPVADRNGSPGGPRMRNT
ASSESVLTDLSEPEVCSIHSESSGGSDSRSQSGHHSADSTHALEATLVSSSLPQSTREGL
NQSFHPKNEKPTRTRAKSFLKRMDTLRVKGALGRHKGPGRTGGLVISRPVLQQEPESFKT
MQCVQIPNGDLQTSPPAACRKGLPCSSKSSGESSPLENSSTVSTPCMKERKCHHEANKRG
GMYLEDLDVLAGTALPDTSDQNHMHGFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDN
SNGVNWRTGSISLGRQQGPGMREPRLMSSCHRASRVSIYDNVPSSHLYASTGDLLDLEKD
GLLPQLDDILQHVNGIQEVVDDWSKNILPELQSHSTLAGDPGLSPFPSPNQVTLDFEGNS
VSEGRTTPSDVERDRTSLNESEATGVRERRDSGVGASLTRPNRRLRWSSFQLSHQPQPSP
ATPHISSQTAAQLNLLQRFSLLRLTAIMEKYSMSNKHGWTCLSAQSAPGALHDLVSVNSR
SVPKFMKRIKAPDYRDKAVFGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKS
GVKSRIHALRQMNENFPDNVSYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQY
VPKEQRLQAVQAAILLLADENREALQTLLCFLHDVVNLVDENQMTPMNLAVCLAPSLFHL
NLLKKESSPKVIQKKYATGKPDQKDLNENLAAAQGLAHMITECNRLFEVPHEMVAQSRDS
YLEAEIHVPSLEDLGAQLAESGATFHTYLEHLVQGLQKEAKEKFKGWVTCSSPDNTDLAF
KKVGDGHPLKLWKASVEVEAPPSVVLNRVLRERHLWDEDFVQWKVVERLDKQTEIYQYVL
NSMVPHPSRDFLVLRTWKTDLPKGMCTLVSLSVEYEEAQLMGGVRAVVMDSQYLIEPCGS
GKSRLTHICRIDLKGHSPEWYSKGFGHLCAAEVTRIRNSFQPLVAEGPETKI
Download sequence
Identical sequences F8WIY7
ENSMUSP00000053232 ENSMUSP00000106109 ENSMUSP00000053232 10090.ENSMUSP00000053232 NP_001156965.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]