SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054767 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054767
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-22
Family Ras-binding domain, RBD 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054767   Gene: ENSMUSG00000044921   Transcript: ENSMUST00000055355
Sequence length 435
Comment pep:known chromosome:NCBIM37:10:101974856:102009194:1 gene:ENSMUSG00000044921 transcript:ENSMUST00000055355
Sequence
MAPFGRNLLKTRHKNRSPTKDMDPEEKEIVVWVCQDEKIVCGLTKRTTSIDVIQALLEEH
EATFGEKRFLLGKASDYCIVEKWRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAF
LPVPLWRTAETKLVQNNEKPWELSPANYMKTLPPDKQKRIVRKTFRKLAKIRQDTSSHDR
DNMECLVHLIISQDHTIHQQVQRMKELDMEIEKCEAKIHLDRVGNDGANYVHEAYLMPRL
SDEEQKLDIQAEINQTLEDLNDSEGMAQLEEQLQYYRALIDKLSAEIEREVKGAGIDGIE
DMEGAAACELENSDLESVKCDLETSMKAGLTIHSHLSGIQREIKYSDSLLQMKAREYELL
AKEFSSLHISNKDGCQGKENRGKEAEAPSSNGETPPLTQRVFNIYTNDTDSDTGISSNHS
QDSETTLGDVLLLAT
Download sequence
Identical sequences Q8K342
ENSMUSP00000054767 ENSMUSP00000054767 GO.34620 10090.ENSMUSP00000054767 NP_666352.1.92730 ENSMUSP00000054767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]