SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000055122 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000055122
Domain Number 1 Region: 396-539
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 287-397
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-32
Family Second domain of FERM 0.00000747
Further Details:      
 
Domain Number 3 Region: 213-291
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.24e-26
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000055122   Gene: ENSMUSG00000019978   Transcript: ENSMUST00000053748
Sequence length 988
Comment pep:known chromosome:NCBIM37:10:25079604:25243320:1 gene:ENSMUSG00000019978 transcript:ENSMUST00000053748
Sequence
MTTEVGSASEVKKGSDQAGADASKEKAKEVENEQTPVSEPEEEKGSQPGPPVERQSTPRL
RKRGKDPSENRGISRFIPPWLKKQRSYNLVVAKDGGDKKEPTQADVEDQILGKEESLPEE
ESRAKGDAEEMAQRKHLEVQVEVREAKPALKSSVETQPAEEVRKDKEETIQDTQEEKLEG
GAAKRETKEVQTSELKAEVASQKATKKTKTVLAKVTLLDGTEYSCDLEKRAKGQVLFDRV
CEHLNLLEKDYFGLLFQDHPEQKNWLDPAKEIKRQLKNLPWLFTFNVKFYPPDPSQLTED
ITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAEHGDYDPEEYDSIDLGDFQFAPAH
TKELEEKVSELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANG
LLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKV
CVEHHTFYRLVSPEQPPKTKFLTLGSKFRYSGRTQAQTREASTLIDRPAPQFERASSKRV
SRSLDGAPIGVVDQSPPGEGSVPGPGVISYTTIQDGRRDSKSPTKATPLPAEGKKNTLRV
DGDNIYVRHSNLMLEDLDKAQEAILKHQASISELKRNFMASTPEPRPSEWEKRRVTPLPF
QPQASSHETLNVVEEKKRAEVGKDESVITEEMNGKEMSPGHGPGETRKVEPVAHKDSTSL
SSESSSSSSESEEDVGEYQPHHRVTEGTIREEQEECDEELEEEPGQGAKVVEREAAVPDA
VPDRQAGASVLPVETEAQEHVVAQKLPGEKGAHGGTAEQDPREEAEEDPHRVNGEVPHLD
LDGLPEIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGG
DSGVLLTAQTITSESASTTTTTHITKTVKGGISETRIEKRIVITGDAALDHDQALAQAIR
EAREQHPDMSVTRVVVHKETELAEEGEE
Download sequence
Identical sequences O70318
ENSMUSP00000055122 ENSMUSP00000055122 NP_001186194.1.92730 NP_038539.2.92730 10090.ENSMUSP00000055122 ENSMUSP00000055122 ENSMUSP00000090314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]