SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000055229 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000055229
Domain Number 1 Region: 16-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.91e-22
Family Ubiquitin-related 0.0000278
Further Details:      
 
Domain Number 2 Region: 606-656
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000929
Family UBA domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000055229
Domain Number - Region: 188-238
Classification Level Classification E-value
Superfamily ARM repeat 0.0455
Family Mo25 protein 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000055229   Gene: ENSMUSG00000051618   Transcript: ENSMUST00000057254
Sequence length 658
Comment pep:known chromosome:NCBIM37:7:111289137:111291793:-1 gene:ENSMUSG00000051618 transcript:ENSMUST00000057254
Sequence
MAKSGEALPQGSLAPAQDSQLIRVTVKTPKDKEDFSVVDTCTIRQLKEKISHRFKAHPNQ
LVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTIGTECPSPPVSIPGPNPGEIPQS
SSVYSVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGSLMWQHISVPELVAQLVDDPFIQGL
LSNTGLVRQLVLDNPHMQHLIQQNPEIGHILNNPEIMRQTMEFLRNPSMMQEMMRSQDRA
LSNLESIPGGYNVLRTMYTDIMDPMLNAVQEQFGGNPFVTATTASTTTTSSQPSRTENCD
PLPNPWTSTYGVSGGRQGRGGRQSGDQDASENRNRLPSFLGNIGLFDYLQQLHETSQSLE
SYLQGTVPTSNPSQESPLSGNRVPPTLPSSPKSGSGQSLPKESVAIKGKSSCPAFLRHST
ENSTGQGGSLHDAGKGSTGPSTSLPNLTSQIGDSANRSSFVSTPSSLMSATPGVPESPWL
PPTGYSRSLRSAGTNQVPRIQNEIHQQLPLLLHLQTAMANPRVMQALLQIEQGLQILATE
APRLLLWFMPCLTGLNGVTGGTEAREGVVMSEDPRPTPTPQISLAQGSTELGIHSSPFLQ
VLQALASTNPQQLQLEAHFRVQLEQLRAMGFLNLEANLQALIATEGDVDAAVEKLRKS
Download sequence
Identical sequences Q497R3 Q8C5U9
NP_941025.1.92730 ENSMUSP00000055229 10090.ENSMUSP00000055229 ENSMUSP00000055229 ENSMUSP00000055229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]