SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000055763 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000055763
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily ISP domain 7.59e-25
Family NirD-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000055763   Gene: ENSMUSG00000043190   Transcript: ENSMUST00000050997
Sequence length 157
Comment pep:known chromosome:NCBIM37:13:76138983:76156010:-1 gene:ENSMUSG00000043190 transcript:ENSMUST00000050997
Sequence
MDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHS
GGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIH
TVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQSSS
Download sequence
Identical sequences Q8K2P6
NP_001124540.1.92730 NP_001124541.1.92730 NP_849247.3.92730 ENSMUSP00000055763 GO.35879 ENSMUSP00000055763 10090.ENSMUSP00000055763 ENSMUSP00000055763 ENSMUSP00000130366 ENSMUSP00000136314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]